DPCstruct | MC47137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 71 ± 6 aa |
| Standard deviation of domain lengths | 5.50 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 69.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287HW28 | 1-62 | MQWTIVDQARAYARAMKATLFFSSATHNINVNKIFKFITAKLFNLPWTVERNLTVGEPIIDF |
| A0A6N2MTB6 | 145-219 | GTKFDDFIQLPIDLQWTIASQARAYAKALNATLFFSSATYNINVNKIFKFITAKLFDLPWTLERNLTIGEPIIDF |
| A0A0G4GP31 | 4-69 | None |
| A0A4S8IL93 | 1157-1231 | None |
| A0A7J0G2A3 | 303-377 | None |
| A0A7J7HCU3 | 119-192 | None |
| A0A5J5A3P3 | 413-487 | None |
| A0A2U1LG37 | 59-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.