DPCstruct | MC47133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 67 ± 7 aa |
| Standard deviation of domain lengths | 6.70 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 66.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02582 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N0V7Z3 | 199-272 | VEKHASGLLPEMRKDEYEVKENPTLSTWMEGGLDYIMLQSLNIDSIRTIGSVLGQSIALDYYVRQSLPTLTVRW |
| A0A287HNS0 | 1-60 | MKFVSKLPDYAVVEKPSLTTWMKGGLDYIVLRSLDTDGIRIISSVLGQSIALDHYIRQVL |
| A0A287HNU3 | 1-67 | None |
| A0A200R9V7 | 5-66 | None |
| A0A2R6PBR0 | 156-221 | None |
| A0A7J7KWV4 | 46-110 | None |
| A0A3N7FGB2 | 26-91 | None |
| A0A4Y7IS54 | 76-151 | None |
| A0A287HNU8 | 1-66 | None |
| A0A287HNS5 | 40-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.