DPCstruct | MC47131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 162 |
|---|---|
| Mean domain length (aa) | 309 ± 57 aa |
| Standard deviation of domain lengths | 56.85 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.93 |
| Pfam Score | 72.46 |
| Assigned Pfam label(s) | PF05190- CL0023- PF01624- PF05188- PF05192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287HL75 | 20-299 | AAGDRSSFVIGLIENRAKEVGVAAFDLRSASLHLSQYIETSCSYQNTKTLLHFYDPNTVIVPPNKTAADGMVGVSELVDKNYQASKK… |
| A0A6D0EKW8 | 1-226 | LLYAEDFAELALIEGRRGLRRRPLWEFEIDTARQQLNLQFGTRDLIGFGVENAPRGLCAAGCLLQYVKDTQRTALPHIRSITMERQQ… |
| A0A162TSG0 | 45-360 | None |
| A0A2I9CJD1 | 128-408 | None |
| A0A7R9KIP7 | 139-412 | None |
| H0EDK5 | 2-259 | None |
| A0A6S7FWY9 | 7-415 | None |
| A0A7S3ZRR1 | 112-413 | None |
| A0A453E8P3 | 2-223 | None |
| A0A7X7XE34 | 100-414 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.