DPCstruct | MC47130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 147 ± 16 aa |
| Standard deviation of domain lengths | 15.79 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.51 |
| Pfam Score | 86.11 |
| Assigned Pfam label(s) | CL0010- PF08148 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287HHV0 | 1-175 | MDHVQSHAHLAKGRREKCMWVPVPLPLLSGLSSVRISIPTDLRPPEARQNILFAVQELGKRYPQGLPKLHPIKDMGIEEPELVDLVH… |
| W5LXA7 | 3-137 | RFRMDPPGQAISTATQELLRLAEAHPGGVATLDPVNDIQLKGVEVVEASMRLRVLQDGLSQFTCVHSPRFSDEFSRLQERMSFQEEL… |
| A0A6A3T3C4 | 981-1134 | None |
| A0A7S3DYQ9 | 7-163 | None |
| A0A7J6VT37 | 1-170 | None |
| A0A835FSR5 | 73-219 | None |
| A0A6A6L663 | 278-413 | None |
| A0A1Y3BRC5 | 141-273 | None |
| A0A818BFU0 | 50-196 | None |
| A0A453AZW3 | 87-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.