DPCstruct | MC47128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 98 ± 7 aa |
| Standard deviation of domain lengths | 7.46 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11452 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K0F288 | 44-136 | ATDPLLPEVAWSWLVDALESRSEPFTALGGTVTSTSSVRYGDIAGPPRAHQLELRASWTAVTTDIRPHVEGFCEVLAYAAGLPPAGI… |
| A0A251XU61 | 2-100 | GTDPFLADVAWSWLVDGLASRGARYSAPSGTATRIISTGYGELARQGSGAKIELRASWTPADSDVTAHVEGWGELLCMLAGLPPAGE… |
| A0A562IE39 | 44-129 | None |
| A0A1C6SNZ2 | 92-188 | None |
| A0A2A3ACW3 | 100-204 | None |
| A0A0G3HAK8 | 197-288 | None |
| A0A1C0AKT9 | 73-172 | None |
| V6KPZ6 | 58-165 | None |
| A0A1J7BAE6 | 109-215 | None |
| W4UF20 | 11-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.