DPCstruct | MC47126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 155 ± 21 aa |
| Standard deviation of domain lengths | 21.19 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832XGL9 | 5-143 | KKSLFPLNRGGLLFSVLEYIILYPIIVFTSFLILTTFFTFLSKNQSIEILMLGAMSLLATVRITAYYSESLSQDLAKVIPLALLAIF… |
| A0A2D6NHN3 | 44-198 | YRFLARKNIINLDLSKYNKYQFGGIYRFFAIIFFIIEYIIILPFITFFWFGVLAILILLLAELELELILIVSAVLIGAIRITSFISE… |
| A0A5N9A5Y8 | 2-127 | None |
| A0A7C5RD87 | 8-162 | None |
| A0A3C1DIJ8 | 32-219 | None |
| A9A3H3 | 61-213 | None |
| A0A1F6ZUC9 | 11-170 | None |
| A0A6L7MIP9 | 26-180 | None |
| A0A832XI30 | 1-112 | None |
| A0A7C8DAU6 | 40-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.