DPCstruct | MC47121
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 172 ± 11 aa |
| Standard deviation of domain lengths | 10.84 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A448YYS2 | 173-344 | TSGSSSASNPSEAPPNPLAGLSEEDQQRYLKYAAMGLGAWTALRALSAILSEALWLALFLPGLYWYGVQTRPADSSFDTKKEVKRVL… |
| A0A7R9ZNP4 | 1-180 | GGSISYSAQHPNQHNALTKLALGGILILFGLRMLASMLFGTMFMLYLIGLPALYFYAVQTCPPAMTFNAKKELKRVLRGHHLPDTHP… |
| A0A7S2EWT4 | 1-165 | None |
| A0A7R9VMC1 | 123-282 | None |
| A0A1E7FQ46 | 10-194 | None |
| A0A7S4AH39 | 1-164 | None |
| A0A7S1AA51 | 7-188 | None |
| A0A7S3L889 | 22-173 | None |
| A0A7S1BVU0 | 204-383 | None |
| A0A7S1UQS8 | 148-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.