DPCstruct | MC47112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 132 ± 7 aa |
| Standard deviation of domain lengths | 6.96 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D8ZNC4 | 9-139 | YSVAAARRILGIYYPEIKVSIQVWAKVVLVISDGRRPRFISKKVFHQHFVDWRKEQAKALVVQRHHLLHSSFNVVNPKKDSMYRVVA… |
| A0A2K8SKT1 | 4-135 | AIVNKSAIARVLGIKTTALVDYEIQSKQVVAKLKVGERTIEFQELVTEFAEYRKRSAKDMVVQPMHSHVYAVYNPKKSTSYEVKTKP… |
| I4IU51 | 14-131 | None |
| A0A7Y0NTB4 | 10-133 | None |
| A0A844MVW5 | 11-148 | None |
| A0A1Z4JP90 | 1-124 | None |
| A0A522X8R1 | 7-141 | None |
| A0A2A2TLZ9 | 1-136 | None |
| A0A252D8U5 | 1-138 | None |
| A0A6N8G2Y5 | 6-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.