DPCstruct | MC4711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 196 ± 36 aa |
| Standard deviation of domain lengths | 35.58 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 64.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317AZE4 | 1-182 | MSMITATTWVPRGFAAPFPSRYQFDEDEYERISKLANLQLEDAKEELEEAQASEKSKNGTSSKASKKDDEDDDDDLKEYDLEHYDDE… |
| E3NQG0 | 4-174 | VLMVSDLSWIQRGVAKEIPDKIKLNDEELKKLIEGAIPESTDNDTDGEDGEEESDHEKPKGIRGKDVEMKDEESEFEKKYMQGYNEK… |
| A0A0G4HSN5 | 7-181 | None |
| A0A4V4MMR1 | 496-750 | None |
| A0A2C5XDW9 | 1-180 | None |
| A0A151GSA5 | 1-208 | None |
| A0A7J7GXD9 | 1-201 | None |
| A0A086Q488 | 4-241 | None |
| A0A287MDN4 | 19-190 | None |
| A0A137QN02 | 321-582 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.