DPCstruct | MC47107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 288 |
|---|---|
| Mean domain length (aa) | 147 ± 26 aa |
| Standard deviation of domain lengths | 26.22 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 19.32 |
| Pfam Score | 96.53 |
| Assigned Pfam label(s) | PF03476- PF03475- CL0065- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F5DKC7 | 9-159 | VKAGLGIIGDRYAAREGTYSGKVATRKSGQKIGDEERQITFISLPGIGQANQILKAQGEQPFTMAETRRSVVVSISAEALNNLEKKR… |
| A0A2I2UD86 | 394-530 | MDVFQPTDQIAYSDASPFLILSEASLADLNSRLEKKVKVANFRPNIVISGCGVYAEDSWDELLIGDVILKRVTACSRCILTTVDPDT… |
| A0A2P8EKU4 | 164-308 | None |
| A0A803QDL0 | 797-948 | None |
| A0A6I9Y752 | 232-408 | None |
| A0A6L7GM41 | 43-172 | None |
| A0A022QYG1 | 375-511 | None |
| A0A849EFP5 | 122-258 | None |
| A0A7R9ZZU8 | 10-177 | None |
| K8EYW8 | 776-946 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.