DPCstruct | MC47105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 352 ± 56 aa |
| Standard deviation of domain lengths | 56.24 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P0PIY2 | 87-454 | VKPNVKPKVALNAASYPLKDYLPTTAWEGTKLPNWNQVTFGSFPGISQGGSFQASSDVIKAVGYDPSRIWLAGQTPDQYMKLGDFQQ… |
| A0A2T1EDJ9 | 138-510 | KFNISSLFMEKVVAQSIPASEQPIPTIYVNGIPTPDWNQITFRSLKFSGSGNSDVPVPETPIPGLKTTRIWNEGQGLSEVMELGDFE… |
| A0A2W4VV05 | 55-420 | None |
| A0A351LCM2 | 2-418 | None |
| A0A6M0RER0 | 19-429 | None |
| A0A2T1LVQ2 | 30-433 | None |
| A0A0P8DB48 | 109-384 | None |
| A0A2T1C2A8 | 100-444 | None |
| A0A6P0WVH0 | 34-441 | None |
| A0A841VIH4 | 3-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.