DPCstruct | MC47101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 150 ± 29 aa |
| Standard deviation of domain lengths | 28.61 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0TA63 | 11-164 | VLLLTLILLVGFLFLERPNRVLGPPLASLPKYVPDFSSYTDVKVKKQDFFEFMLPMIRSANILVSYERAFVTTMTDKYTAGQTITTD… |
| A0A369WEI1 | 52-190 | LQRSSNAPSLRLPEPGPTLPDFGAIKDVKQKKQQFFAYLEPMIAQENAHTQALRSHFEQLLELLERQPQLHPDDQQWLAQVNKSFRI… |
| A0A523FGY5 | 188-310 | None |
| A0A220VBJ7 | 3-126 | None |
| A0A2D6T279 | 100-299 | None |
| A0A6N9CID9 | 4-186 | None |
| D5BU90 | 142-342 | None |
| A0A7X1HQN8 | 1-170 | None |
| A0A377ACE2 | 39-212 | None |
| A0A4Q0YZ12 | 23-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.