DPCstruct | MC47100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 184 ± 29 aa |
| Standard deviation of domain lengths | 29.34 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11932 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0T680 | 26-187 | GQLEQSIDNVTVIERQIGPLIERMIANLEKFVELDVPFLAQERADRVAFLRETFDRADVSVAEKFSQVLQAYQVENSYGSTLDVYTE… |
| A0A847GIC5 | 133-333 | EFANAQAVYDDLRNETAIIQARQRGLVAEVDRLTGYVGELDEANARRVATKEALVHNIDRLLIQVKESIPLAPQKYEYNARIQQVQA… |
| A0A812ZQ11 | 29-221 | None |
| A0A2E9RLJ9 | 64-254 | None |
| A0A090P493 | 3-142 | None |
| A0A1S9CZ67 | 55-248 | None |
| A0A657AKE9 | 31-215 | None |
| A0A1Y6D3A5 | 2-248 | None |
| A0A420EH08 | 54-216 | None |
| A0A849T4E6 | 50-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.