DPCstruct | MC4710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 85 ± 7 aa |
| Standard deviation of domain lengths | 7.09 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.00 |
| Pfam Score | 82.50 |
| Assigned Pfam label(s) | CL0063- PF17391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E3NQC9 | 1-89 | MGLSSLAGKVFVTAGLGGMSGAQPKAAKIAGCIGVIAEISETALLKRHQQGWLDVYSKDLEEIVNWIKEYREKKAAISIGYLGNVVD… |
| A0A7C1T3B2 | 1-81 | YNGNLKGKWILTGGLGGMGGAQPLAAVMAGACCLAVECDETRIDFRLRTRYVDAKAHTLDEALALIDQWTKAGEAKSVGLV |
| A0A7Y0RQH2 | 3-75 | None |
| A0A3P0XF51 | 13-108 | None |
| A0A820X0J8 | 188-275 | None |
| A0A1Q6YJR6 | 4-80 | None |
| A0A444UZ79 | 39-120 | None |
| A0A6B9YN92 | 14-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.