DPCstruct | MC471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 9.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 32.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E8P6M4 | 1-83 | PIICALFLAYGLFGEHLPGDLAHRGYGFDQIVNQLSFGTEGLYGTPTYVSATYIYLFILFGAFLEQAGMIRLFTDFAMGLFGH |
| A0A0B8Q1H7 | 35-114 | PILVGLALAYAYLGEYISGVMGHRGFDIFYLTEVIYLSDRGMWGMLVNIASTTLASFILFGSFLLHTGAGQTFLDMSSRI |
| A0A3B8UNQ0 | 20-121 | None |
| A0A7V2TX67 | 125-206 | None |
| A0A2G2JF72 | 2-102 | None |
| A0A6B1HP68 | 141-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.