DPCstruct | MC47098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 96 ± 15 aa |
| Standard deviation of domain lengths | 14.86 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A656YTE4 | 1-95 | MIEGRTEQDVLYELLIKRGIDLAVPIESRNVSGKEVYSIGYGVLFACLDESITRADVENIAQGILKWYGELSPSSDTHVFFRDSAKT… |
| A0A830Y8P7 | 55-164 | ILEGRSEEDLLTELMLKRGIDLSVNVETRQFDELTVSCVDGGKLFTCFTRQIPASSVEALTKGIIDWHKSLKAGKDTVCYFLDDAFE… |
| A0A097EIH9 | 1-114 | None |
| A0A166AJQ4 | 188-291 | None |
| A0A6N9CM10 | 2-110 | None |
| A0A3B0Z7E0 | 24-100 | None |
| A0A1N6Q6F2 | 290-386 | None |
| G2SZV7 | 135-239 | None |
| A0A378N6W6 | 9-99 | None |
| A0A5Q3S0U7 | 77-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.