DPCstruct | MC4709
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 135 ± 14 aa |
| Standard deviation of domain lengths | 14.37 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 28.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02343 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9U5B1 | 25-160 | PQETTSSAPELCRDPNPSTCEDFKEWTVSPAEYIEKDGCFMLTCPENTYPSFFSQFQYSEIPPPGNLIPQNALEISPPTSLEEMGGA… |
| E3NJ28 | 19-149 | CKEVCECPDLLDRLSWPEKNETLYTEEAGCVKNITCRPSYDLTFVAFIFTDSEIPRPVDSNNAAGGITINPEVETGPNINIFEFFGM… |
| A0A1I7TGV8 | 66-194 | None |
| A0A1I7TGV9 | 22-168 | None |
| A0A1I7TGV5 | 192-337 | None |
| A0A1I7UJN0 | 265-401 | None |
| G0P0R3 | 14-149 | None |
| C8JQQ2 | 68-222 | None |
| E3MUP2 | 81-204 | None |
| A0A0M9JJ82 | 5-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.