DPCstruct | MC47089
Metacluster Properties and Pfam Annotations
| Number of structural domains | 272 |
|---|---|
| Mean domain length (aa) | 155 ± 29 aa |
| Standard deviation of domain lengths | 29.05 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0WX77 | 14-166 | VTAGDLITTPETTAVYYYAEDGKRYVFQNEQTYYSWEDSFDDVKTISADDMAEIELGGTVPYQAGTTLVKMPSVPTVYAVEPDGVLR… |
| A0A1U7GK34 | 292-482 | TKAVSTDDFQAVPKGPDYYPDGMFVRSDQTGEISRYSGGKFHVVSTPVSAYLGIGVDSVATIPAAQYGNTPKGDDYFPENLLIQNQQ… |
| A0A6F9ZYJ0 | 52-266 | None |
| A0A7T9BTB7 | 108-265 | None |
| A0A7C2PC72 | 94-239 | None |
| A0A6F9ZZY8 | 321-456 | None |
| A0A6F9ZZK0 | 21-158 | None |
| A0A6F9ZY97 | 357-485 | None |
| A0A1F5PMN4 | 32-208 | None |
| A0A6J4HPX4 | 173-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.