DPCstruct | MC47087
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 209 ± 40 aa |
| Standard deviation of domain lengths | 39.68 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 27.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0WW48 | 8-262 | ILEERRALILLTEKYGFSLNDADKILAMLKTEKNAREMKFKSAQKIRRNYEPSNIEVDETEVLNKRHAALAGKVDVKPVEPVLPGAR… |
| A0A1F7V7U9 | 1-138 | MASNQPLEPIIIKAPMPSRKPTMIDVHAKPSVVGPIDELKLFTIADFRRFDADPRRAAARLQEKIKLLEEESYAKMVEGVRAWRASP… |
| A0A3A4ZNS4 | 143-289 | None |
| A0A1F7WDJ1 | 243-441 | None |
| K1Z1S2 | 97-308 | None |
| A0A2H0YT53 | 207-462 | None |
| A0A2H0SF61 | 1-110 | None |
| A0A0G1MXE7 | 219-441 | None |
| A0A2M6W2Q3 | 61-277 | None |
| A0A2M7H274 | 512-748 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.