DPCstruct | MC47081
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 277 ± 41 aa |
| Standard deviation of domain lengths | 40.67 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B7MRW0 | 78-395 | SSSRAGTRDKHAAVVSRVSSRAPSPASSYSNSHGRPSISSSRTTFRSPLVKLHRAPLLRVFVPSPGGEWLSDSSVIECEAELKRAGV… |
| A0A7D8V3B3 | 3-219 | GRAPILRVFVPVSDRVPRWPSSEGAAASWRELEKCGADKRMKLGDLVVNTALHKPTNTEHVLVYVPFVAHKLVPLEYVHSPTGHLPR… |
| A0A5M3N6N7 | 49-328 | None |
| A0A427Y7D1 | 201-445 | None |
| A0A0C9VKU1 | 22-276 | None |
| A0A4Z0A2E7 | 90-388 | None |
| A0A2A9NXK0 | 200-507 | None |
| K5VP90 | 266-549 | None |
| A0A137QXV9 | 152-527 | None |
| A0A177VRU7 | 982-1264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.