DPCstruct | MC4708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 483 ± 67 aa |
| Standard deviation of domain lengths | 67.04 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0JNP5 | 4-454 | LHKNQLNKSLEIYNFDKKIRLGDNSDGGYVIADLDGLYDCYISCGISNEASFDRDFLKKYINIGKNNAYAFDGTIKDYPWQYTTDIQ… |
| E3NH39 | 1-483 | MIDSPSTVIISLLSCFLIISTLTCFSVSRLEQKFEADELIDLYNPNALKDLRAKYNLKADKYSLELSQVARGANHKRFFGKVKLEAF… |
| A0A1Y2BRV1 | 24-416 | None |
| A0A521QQ93 | 74-541 | None |
| A0A813YM59 | 52-584 | None |
| A0A2A6BQ00 | 181-748 | None |
| A0A1I8HI36 | 535-1036 | None |
| Q00S85 | 21-530 | None |
| A0A812XA20 | 15-388 | None |
| A0A2E5R413 | 228-662 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.