DPCstruct | MC4707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 121 ± 16 aa |
| Standard deviation of domain lengths | 15.73 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0NCK1 | 2-106 | ACVNFNAPLPTSKPPTCDCPSQYITNSTEPGYELNNFYVRGEISDDRCSWNISCANSRIAQGRVNGHLYKSHFFAGLCNGGTQKWIV… |
| E3NDJ4 | 1-127 | MLSFLLFLLFPSVIQTCLVIRYSEPPKCECEWIALTSSNIEEFIGQSSFYIQNITGKEVKVPLSTEEDCSLSIYCDKWSLVIMDKTT… |
| G0NCQ5 | 63-165 | None |
| A8XXG0 | 10-144 | None |
| A0A1I7UX18 | 7-119 | None |
| A0A1I7TTR7 | 73-172 | None |
| A0A1I7TCB8 | 1-94 | None |
| Q9BKT2 | 64-170 | None |
| A0A6A5HU96 | 63-186 | None |
| E3NGB3 | 1-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.