DPCstruct | MC47065
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 545 ± 29 aa |
| Standard deviation of domain lengths | 28.69 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A256W763 | 1-601 | MDTQNFFPDFQPNQVLTNTQLNQLRQYLDDQTRLGRVRLVGTGIVCGLYANLEGNHSIRITGGYGVTSDGYIIELKNTTYTKYRNYT… |
| A0A848N2Y8 | 9-525 | STQYRKFSKGQYIEHTQFNEFLDFFEDQDRLSRVMLQGVGIVCGLKPKPVYKDRLLKSIQLSQGAALTTDGDLLTLNKTNKVSEELY… |
| A0A5B8UXP1 | 1-551 | None |
| B3QN01 | 1-561 | None |
| A0A4R1ACC4 | 9-513 | None |
| A0A4S3ZP92 | 11-539 | None |
| A0A2G1C389 | 10-585 | None |
| B9M762 | 233-795 | None |
| A0A316WS33 | 9-527 | None |
| A0A101JIX8 | 1-527 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.