DPCstruct | MC47062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 208 ± 32 aa |
| Standard deviation of domain lengths | 31.86 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 26.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B8X0I7 | 26-231 | PVSYPVPPINEPASSNPNERGSLAWYGANYDKAEINPKYLSSAKKAAQTVLAGKERYKVIADHFGLPWWVIGCIHWREASCSFKGVL… |
| A0A7C9IWV1 | 10-196 | DLADAYRNLFAAATLRPERAGEVARMARRLAEPVRANRYRTVADRIGAPWFVVGILHALEASLDFGRHLHNGDPLSARTVRVPKARP… |
| A0A2M7QHH1 | 220-479 | None |
| A0A423IGV9 | 9-193 | None |
| A0A1V5FFM3 | 6-199 | None |
| A0A1E3GYY1 | 2-202 | None |
| A0A1I3VT36 | 87-326 | None |
| A0A7T7YEJ1 | 5-190 | None |
| F2JHS3 | 564-748 | None |
| A0A7C3P8A9 | 263-483 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.