DPCstruct | MC47059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 96 ± 9 aa |
| Standard deviation of domain lengths | 9.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0446- CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B8YH18 | 1-104 | MGSDIESLPIPEEKDFRDYILVFPANLGIKPIYVMFNTPRNQPGVVTGRGQKVEGNWLNLAGQDMGASIPSQIADKLRGRTFNNFDD… |
| A0A495PNB8 | 248-336 | ERLIITFPMDSGLPPILVLFKSPRYEAGTSTGNGAQVTDTWRKSAASLEGAPIPAQIADLLRDREYRSFNAFRRQFWKAVANDPELS… |
| A0A828SF48 | 991-1086 | None |
| A0A4Q9QJ39 | 208-303 | None |
| A0A2K4VMT9 | 499-593 | None |
| A0A2N0DRJ2 | 4-97 | None |
| A0A514F033 | 1-94 | None |
| A0A510UHM3 | 489-594 | None |
| A0A6A7Z2Q1 | 116-211 | None |
| A0A2R7RE18 | 286-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.