DPCstruct | MC47058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 82 ± 13 aa |
| Standard deviation of domain lengths | 13.46 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 35.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I1IZT1 | 1-107 | FRYEAYVRPSSVQSQDYTFKVPDWPGMYEQQGENLNGQLAQYEIFDYPGRFKDEQHGKDFTLYQMDSLRSDAEKATGQSNSPKLWPG… |
| S5N0E8 | 34-106 | RYRARTGPSSVEIQDYTFRTPAWPGYYSHAAENLNGQFTRYEIFDYPGRFKDESHGRAFARYRTEGWRSGRRS |
| A0A6D2GBV7 | 86-157 | None |
| A0A1I3FF82 | 148-221 | None |
| A0A562Q2V2 | 128-209 | None |
| A0A2T0UJT8 | 27-135 | None |
| A0A3L2XZU9 | 59-141 | None |
| A0A8B5IQX0 | 102-171 | None |
| A0A1B8YBA3 | 118-224 | None |
| A0A4Q6WPE6 | 222-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.