DPCstruct | MC47055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 184 ± 19 aa |
| Standard deviation of domain lengths | 18.93 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.50 |
| Pfam Score | 94.81 |
| Assigned Pfam label(s) | PF02671- PF08295- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A8JH38 | 341-533 | YLTKPLSEIVSGDTERVTPSYVKMPPGYPHLVSTGRTPLADSVLNSEFVNVITGSEDYSFKLMRKNQYEESLFRCEDDRYEFEMAIE… |
| A0A060Z3J4 | 7-198 | SCKRLGSSYRALPKSYTQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRALEAV… |
| M4CWY0 | 8-192 | None |
| A0A5K4F1Y2 | 18-211 | None |
| A0A6A2YAD4 | 44-218 | None |
| A0A6J3CBY4 | 15-197 | None |
| A0A811MYK2 | 561-751 | None |
| Q6FNH7 | 274-471 | None |
| A0A6S8VHN3 | 212-387 | None |
| A0A0C2MR01 | 202-385 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.