DPCstruct | MC47054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 480 |
|---|---|
| Mean domain length (aa) | 61 ± 8 aa |
| Standard deviation of domain lengths | 8.14 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.42 |
| Pfam Score | 99.03 |
| Assigned Pfam label(s) | CL0123- CL0010- CL0229- PF00194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A8JG20 | 3-56 | YDDTLCARCGGGDDPASILLCDTCDAGYHMACLDPPLEEIPDDDWHCPKCTASD |
| A0A0R3S0U1 | 83-136 | LNYRWNCIECKKCTICEKPDNEDAMMFCDRCDRGYHTFCVGLSSPPIGNWICSS |
| M1VAY5 | 73-145 | None |
| A0A0N5D9G6 | 8-88 | None |
| K3W761 | 394-446 | None |
| A0A158QV46 | 963-1040 | None |
| A0A5K4FAV3 | 1309-1380 | None |
| A0A7J8IDA2 | 323-380 | None |
| A0A482VMP7 | 178-236 | None |
| A0A1U8P997 | 76-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.