DPCstruct | MC4705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 182 |
|---|---|
| Mean domain length (aa) | 216 ± 38 aa |
| Standard deviation of domain lengths | 38.03 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.09 |
| Pfam Score | 93.90 |
| Assigned Pfam label(s) | CL0112- CL0167- CL0530 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2XC46 | 5-153 | TSEETLKALRDWDLWGPLLLCLTLSIMLSVTAPAAQSAMVFTGVFVVIWVGAAIVTINAQLLGSSISFFQSVCVLGYCVFPLNIATL… |
| E3NAU6 | 21-246 | AGGVGDEQNPQFGMQAQLGKMMWEAGSKQVQDTFQSYGRIDLFRPYFDVDPAEVRTRLIRSFIPRKPAQIQVSPDLYGPSMIILTMV… |
| K8EM21 | 54-367 | None |
| A0A813A2H9 | 267-478 | None |
| A0A0V0QBZ9 | 24-241 | None |
| A0A3A1P596 | 5-241 | None |
| W5LXZ3 | 2-168 | None |
| A0A7M3RUK9 | 4-157 | None |
| A0A4V6WKI3 | 230-455 | None |
| A0A822D289 | 11-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.