DPCstruct | MC47049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 213 ± 22 aa |
| Standard deviation of domain lengths | 21.50 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.87 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.21 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF09368- PF04000 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A8J0A8 | 2-217 | TRGMGGAAGGASDRGNALNDLFARQKVSQRYGTDHPSLTARPKGGDEDLPLREPLHERRAKFDAAAARRAARDGAGGFGGDEDDGAE… |
| A0A161HFD3 | 376-597 | SDYREEDIDEVSIADKLARKKSLRFYTSKIDQQTNKANNGREKFSGDADLPYKERHFERQQRLMEEARKRGLKTSGGAYDPADDFGS… |
| A0A015JU58 | 139-388 | None |
| A0A2N9H7K8 | 243-450 | None |
| A0A7J6R1Q4 | 1-190 | None |
| A0A811PJL3 | 249-425 | None |
| A0A7S3CG01 | 87-349 | None |
| A0A7R9T3T4 | 276-474 | None |
| A0A4U6VXB2 | 36-240 | None |
| A0A7S1Z7S1 | 104-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.