DPCstruct | MC47047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 7.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V9E3X8 | 1-103 | MITEFHQTSGIKVYNSTIDSWGFSAAITNTNHPELGFLFMIRVNVTDGVLPPGLHDADFPNNLYDIEICYSNLRELPDDLDSIWMVG… |
| A0A6A4BT86 | 137-215 | FQSLGSLVAIHVYNSTIVSWDVESSISATAHPRLLSVVLVRLQMVKVPQGVLQPLPATVLGVQFSHTNIKTLPNDLYLR |
| D0NTF3 | 210-293 | None |
| A0A329RDC0 | 286-376 | None |
| W2FTM8 | 33-134 | None |
| A0A662WRN0 | 767-856 | None |
| A0A662WRH5 | 372-455 | None |
| D0N5W1 | 225-314 | None |
| K3XB46 | 198-288 | None |
| G4ZCU6 | 420-513 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.