DPCstruct | MC47040
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 71 ± 3 aa |
| Standard deviation of domain lengths | 2.90 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 93.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 31.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842PH21 | 14-79 | KLTFTDGDLSFSDSIMCGPDEEFHCGSIVEHSSGLWRIRALHSGKGRTLNGKMKAVNIRRVFLHLP |
| A0A5E4J738 | 79-148 | TDEVPLKISVYRNGVTRPLKISVPGDEVLELGEVRQVKGVKFCIVKIKLRSEGFAADTAMAKDIVRVWGR |
| A0A662NVF7 | 85-156 | None |
| A0A2E1SR03 | 137-205 | None |
| A0A6V8DBJ2 | 4-79 | None |
| A0A7C7PHK1 | 2-70 | None |
| A0A662VPB5 | 113-187 | None |
| A0A832TA65 | 157-228 | None |
| A0A7J4SX94 | 67-135 | None |
| A0A7C5BA76 | 184-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.