DPCstruct | MC47037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 250 ± 46 aa |
| Standard deviation of domain lengths | 46.28 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 19.39 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | PF17481- PF04984 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X1TGF3 | 3-279 | TYPGIYIQELHASAHTNMAAPTSITVFIGYTHPFKTPPNNFGIPVPVFSFSDYEDQFGGFFQSSVVDCNVARAVNDFFLNGGAHAYV… |
| A0A4U0YKK7 | 4-291 | NVSFNQIPVDIRTPGQYIEIDNSLAVQGLPGMPRKVLVLGQRLTGGSVEAETPVQVLDGEQGEGFFGRGSQIAGMLKALRAVNRTSE… |
| M6ZU16 | 1-280 | None |
| W4V8J5 | 1-251 | None |
| A0A1C4YDG5 | 4-193 | None |
| T1ANX0 | 11-171 | None |
| V6HZ19 | 1-285 | None |
| A0A7W5AHD9 | 1-216 | None |
| A0A072TPP1 | 1-290 | None |
| A0A379KEV1 | 14-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.