DPCstruct | MC47036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 189 ± 27 aa |
| Standard deviation of domain lengths | 27.41 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X1NL01 | 2-184 | TMERIAIGNKALTLAKAVKEPQFSMKTVLTLDPFDYVDLWLRREHKDEALHYWRQARNIHRAAGGLPIESAPLVLYYCFMNAAKALL… |
| A0A6P2T8X5 | 157-388 | ARNGEVLTVKGRPIPYSRHPVVRTSRRYGLQSRIFSTNPWGIIRQSIEDNLTGVSRDQAIAFVAQAENFYKTSQTSTLLSAKPLLIY… |
| A0A445MV44 | 22-227 | None |
| A0A1Y0EDC7 | 34-218 | None |
| A0A7V9UBJ2 | 20-210 | None |
| A0A6C2D0P7 | 1-142 | None |
| A0A1C5MZC7 | 1-203 | None |
| A0A2U1CY21 | 6-239 | None |
| A0A328XWV7 | 2-170 | None |
| A0A7U3CNT3 | 1-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.