DPCstruct | MC47031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 190 ± 39 aa |
| Standard deviation of domain lengths | 39.39 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521GH65 | 45-205 | KPANSQQLATWQANQLKAYHGSLHHLLASLLRGTHEAEGFMVYQTPLVMDGSAGGTQAMPLVLTPERQMLDATRAMALFRPGELPFE… |
| A0A2M6YYT4 | 224-398 | SVLHVENRALGYRIDIVLERFEHDPEERRGTYVFYPKFEELLPANKEEAAAWSKNRRKSYTGSLKHFLHALVSGHMDNEMFAVYTGT… |
| A0A7Y3WBZ8 | 30-226 | None |
| A0A519TDZ2 | 1-171 | None |
| A0A2S1LNU8 | 12-173 | None |
| A0A2E4HF83 | 51-293 | None |
| A0A3S4WUM0 | 28-176 | None |
| A0A2N2YWL2 | 130-401 | None |
| A0A352FCA1 | 55-288 | None |
| A0A7Y3RXD5 | 10-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.