DPCstruct | MC4703
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 316 ± 29 aa |
| Standard deviation of domain lengths | 28.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5N2B9 | 5-301 | AVSQVPEAPALEGLKGIPVPEPSNINQFIANKAAAIRLGKALFWDTQVGSDGKTSCASCHFHAGTDNRTINQISPGLLRVASPGNAD… |
| A0A1H9D902 | 23-328 | GSLLLADGFGPIPMSLKGAPVPNVPGLVGGSDPIIINKNKALILGKALFWDINVGSDGIACATCHFHAGADRRIKNQIAPAGKNSEL… |
| A0A7Y4SK74 | 4-333 | None |
| A0A7C7U790 | 38-408 | None |
| A0A3M2I0F7 | 2-321 | None |
| A0A3L7T7P7 | 1-310 | None |
| A0A1Q2M5L4 | 24-351 | None |
| A0A1Y6CVW6 | 3-343 | None |
| A0A0D8ZUI0 | 1-257 | None |
| A0A5J6WMB0 | 314-561 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.