DPCstruct | MC47027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 119 ± 15 aa |
| Standard deviation of domain lengths | 14.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.06 |
| Pfam Score | 94.72 |
| Assigned Pfam label(s) | PF04241- CL0125- CL0123- CL0177- PF18125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0B1S1 | 9-134 | DLVLILLICLAGFLAVAIGAFGAHGLKKIISADLMITFETGNKYHFYHSITALFVFLMLILSEQNETSEKSNKYLRLSIWMFLTGIL… |
| A0A2N1Z811 | 5-119 | FLLLAAFGGFTGVGLGAFAAHALRGQLPQNLLAAFQTGVQYQFWHSFALIATALLLLRWPQSRLISSAGWLFALGILLFSGSLYLMA… |
| A0A154PHG6 | 162-278 | None |
| A0A813P6I2 | 404-520 | None |
| A0A7W0PRE8 | 1-136 | None |
| A0A5C5U4P7 | 2-101 | None |
| A0A109FN67 | 7-133 | None |
| K1PKR2 | 47-161 | None |
| A0A381GC21 | 2-102 | None |
| A0A3M6WGR7 | 2-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.