DPCstruct | MC47022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 190 |
|---|---|
| Mean domain length (aa) | 148 ± 27 aa |
| Standard deviation of domain lengths | 27.17 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 26.52 |
| Pfam Score | 82.95 |
| Assigned Pfam label(s) | PF00673- CL0010- PF01877- CL0652 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535SVW2 | 8-157 | GNVMQVPRLNKIVVNVGIGEAKDNDKALDAAVGDVTTITGQKPQLIKARKSVAAFKLREGQTIGIKTTLRGRRMWYFLDKLLNVALP… |
| A0A833DRS3 | 50-175 | RKVEILIETTVHPTEDVNKVIQAVKNIFPDAEVEIENGKLRAKAWDLSKFRDLLRKQRILDTARSELYRGVSGNEITIYLNKQTAVI… |
| A0A5J5VE79 | 1-151 | None |
| A0A4T0KII6 | 2-160 | None |
| A0A1W9SIS5 | 2-141 | None |
| A0A0G0PDR9 | 3-141 | None |
| A0A1X2IIX7 | 344-515 | None |
| A0A7C7LU48 | 2-115 | None |
| A0A1D2NCK3 | 10-166 | None |
| A0A1W1B8M3 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.