DPCstruct | MC47020
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 367 ± 159 aa |
| Standard deviation of domain lengths | 159.27 |
| Length coefficient of variation | 0.43 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847AD07 | 22-193 | RPFPSFPFKINKGIIIAAAAGLALLVLLPAMAEFYSELLWYSSEGYRSVFWTRLLARIPLFLAGFVLYTTLLWLNFNSARKNLGAHL… |
| A0A538DRX6 | 1-361 | MPGRESARRPRLRRPNRGGIIALVVVVALLVLLTSLRGIAGFYTDYLWFHSLGLAGVWKTIVGSKLVLTLIFLAIFFVLLFTNLLIA… |
| A0A7C4I562 | 2-543 | None |
| A0A426VVB1 | 1-185 | None |
| A0A251XSR3 | 1-162 | None |
| A0A2V7IFY8 | 49-470 | None |
| A0A336PAR6 | 1-182 | None |
| A0A4D4KB26 | 2-384 | None |
| A0A1Q7TD10 | 12-412 | None |
| A0A2D6D2I4 | 281-764 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.