DPCstruct | MC47012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 254 ± 28 aa |
| Standard deviation of domain lengths | 27.64 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2NPG3 | 2-204 | ASLLSQLIDGNLIKAMFVFFGTPLFICYLCIAALNQTVRKTTSACGIAPILPDNDRPLVLTRLAHDQCSALSHWAWSSILLKVHILG… |
| A0A7J6UIH6 | 1-243 | MSGAVMGFAGAGSLVLFIWAFMAFGKARLLEVAHKSPLVASLLDMASSDWARAFFICMVNVGLLIAVLLDFLRQCVRSLWWTNRPLE… |
| A0A812W4H9 | 461-682 | None |
| A0A0M0KAM5 | 9-293 | None |
| A0A7S2LL64 | 233-501 | None |
| A0A7S4IIC0 | 7-247 | None |
| A0A7S0B946 | 426-709 | None |
| A0A7J6P274 | 594-876 | None |
| A0A7S0AKW3 | 2-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.