DPCstruct | MC4701
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 94 ± 7 aa |
| Standard deviation of domain lengths | 6.72 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12112 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S3AFV4 | 5-96 | YEELLILGITMEGRPFRPSDWSERLCGALAVHNRNNRWEYSEYAQPVIHEGKIGVHVKTALKDINPVMYQFIMDFAYNNQLRIIPTG… |
| A0A1G5QH27 | 3-90 | EQTGKIIIKGVTRDGRKFRPSDWAQRLTTAVARPGPKGRVRFHPKVAMTTKDGVNCVVIDRSLEEEDPMLFEFLTNFADFNNLDVEET |
| Q3JEW0 | 83-172 | None |
| A0A1Z9BEB5 | 2-99 | None |
| A0A7C9JVT3 | 11-92 | None |
| B5QS74 | 34-127 | None |
| A0A3D5AXV7 | 7-105 | None |
| A0A1G5CMF1 | 15-105 | None |
| A0A2H0IVW7 | 6-103 | None |
| A0A811AIC9 | 119-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.