DPCstruct | MC47006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 219 ± 25 aa |
| Standard deviation of domain lengths | 24.56 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 67.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0437 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3K5D4 | 1-261 | MCVNKENSVPFPVPIVLKAMDDIKFHVKEGHNAKKQALALIKELPAVLPLERAKMKIKFSCTNEEKVSVVKSWMTETYDKQESEEEG… |
| A0A7J6U6G7 | 2-220 | VRVGTQTMTALNKGKKEVNEAKVQAREAMKALEEKMPDRIVRASMRVRIVHPSDDDKFDNFLAEVKKILNSEGETSPVFGKVDSVCQ… |
| A0A7J6N0G2 | 328-559 | None |
| A0A397BHS8 | 393-593 | None |
| A0A314ZGY6 | 1-182 | None |
| A0A059BHK0 | 114-315 | None |
| A0A4Y7JQF9 | 67-269 | None |
| Q4UGS9 | 12-261 | None |
| A0A5A8CW86 | 152-394 | None |
| A0A3R7BFE5 | 302-502 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.