DPCstruct | MC47001
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 140 ± 15 aa |
| Standard deviation of domain lengths | 15.30 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02661 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5SLR1 | 3-131 | DFDEYIRQGEPQKREKSYAWQTAIGLQAVDGLKPSDYLIETARKDIEGEITFNEAKQLIRSYYQSKASRTPEDSETYEADTASTHIR… |
| A0A2V1IQL7 | 10-160 | YLRATEPGPKERAELWQTAIGLQKVDGLEVSDYLVDTAKRHIEGEVNIDDVDKLITTYYQSEAAREIPDDVKQADEVSKNIVRVLSE… |
| D4IW01 | 7-158 | None |
| A0A2N3QMM2 | 429-594 | None |
| A0A4R3Y3C7 | 3-137 | None |
| G9WNG3 | 3-159 | None |
| A0A0Z8KYC2 | 4-154 | None |
| A0A1M6TEN2 | 14-150 | None |
| R6H169 | 4-138 | None |
| A0A4S2FJC8 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.