DPCstruct | MC47000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 78 ± 8 aa |
| Standard deviation of domain lengths | 7.69 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 95.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838KJJ0 | 58-131 | AVTDYMRAVPDQISQWVPSDWHSLGTDGFGFADTRAAARRYFRVDAESVVVAALEALAKRGEVDKSWASKALAK |
| A0A103PP93 | 1-77 | MRAVPELIRAYVPRRYVPLGTDGFGRSDTRRALRSFFEVDRESIVIAALKALADEREIGADVVHAAQLSSRAARRDR |
| A0A562WCC1 | 85-163 | None |
| A0A3D3BZ88 | 38-122 | None |
| A0A4Q8CC76 | 48-125 | None |
| A0A4Q4D8E8 | 33-120 | None |
| A0A653ZVE9 | 1-74 | None |
| A0A5E6NWL5 | 18-78 | None |
| A0A7S2BNG8 | 92-172 | None |
| A0A645JJ78 | 34-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.