DPCstruct | MC470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 76 ± 9 aa |
| Standard deviation of domain lengths | 9.10 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 27.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U2YB65 | 1-64 | MEKYTQFSSFDDFLKAGGFFVETQEDFEAIPDEDMDKHVAKTTKFSDWQTMLDTAVSEYALKKL |
| A0A1M6AEH3 | 18-93 | MSAEKLFNHEFMREHTSFISFEQMIKSSGITMKEIKSISNLESLGSDVFNDFIKNGTKFESWQEMLEKARETMLHK |
| A0A1C3F6F0 | 54-126 | None |
| A0A6N2ZUS5 | 16-87 | None |
| A0A830EMD3 | 61-142 | None |
| A0A414NVH6 | 20-92 | None |
| N9CZ16 | 22-99 | None |
| A0A6N8B412 | 15-84 | None |
| A0A812FTS6 | 103-186 | None |
| A0A5N0KT71 | 9-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.