DPCstruct | MC47
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 186 ± 24 aa |
| Standard deviation of domain lengths | 24.30 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 38.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K1JWC4 | 22-147 | EDAEIGFGARLLAARSGSEITATLAELARTAGGGALAQPLLQALYPAAAAIFPLRASEAKLKAARLFGLELEGLSPEDKEFELALHF… |
| A0A353Z8I0 | 141-341 | EYAQEASVGHEIVAGEGEALFEEEVLELTAELLSVNNEEELDRFLGKLVRRVSRAAGNFIRSPVGRLVGGVLRQVARRALPIAGAAL… |
| A0A6L6QB92 | 33-262 | None |
| A0A850B5S9 | 170-383 | None |
| A0A7V4Z0L3 | 1-195 | None |
| A0A1H4BD17 | 16-198 | None |
| A0A2V6QNF0 | 3-187 | None |
| A0A519DVX3 | 2-166 | None |
| A0A520FZJ8 | 37-247 | None |
| A0A520CDV1 | 235-431 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.