DPCstruct | MC46996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 249 ± 12 aa |
| Standard deviation of domain lengths | 12.13 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6N2P1 | 1-226 | MTDQVIEDQKHSLDKWIEYFLYDEESKSYEMWEKYWVFQGLQNLGKYDKKTYKFSKRDKTTVYPFPPVEREFIFTTLHLMEDYIKDK… |
| A0A1Q6TW04 | 76-319 | NKINEARAERLNKWKNFLQEPGAAKGLFDEPVDEELAAKIENNNALKLIVWNAVNSEVKENNRHIPVPFNQKALKETVNYFNDLAPK… |
| A0A849WSS8 | 138-390 | None |
| A0A2T2QUR3 | 86-351 | None |
| A0A4Q6CL32 | 128-381 | None |
| A0A1F6WHY2 | 87-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.