DPCstruct | MC46994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 121 ± 8 aa |
| Standard deviation of domain lengths | 7.85 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 26.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0F4I2 | 24-147 | MGNRAVISTEVEGIPKKYSPSIYLHWNGGRPSVEAFLKCAKILGVRLGDNQYSLARLCQVISNFLGGTLSIGVGVYANMDTDNGDNG… |
| A0A388TCW4 | 1-120 | MGNRAVITTEEKRIGVYLHWNGGRDSVEAFLQYCKDQQFRPPEEDCYGWARLCQVICNWSGNDGLGIGIDEYERLDTANGDNGVYII… |
| A0A2E3DFT7 | 1-131 | None |
| D0YR07 | 2-127 | None |
| A0A1Z9CI08 | 1-108 | None |
| A0A3C1GAA1 | 1-119 | None |
| A0A2E7VYW9 | 1-121 | None |
| A0A843FST0 | 1-123 | None |
| A0A160PQD3 | 1-123 | None |
| A0A843D0T0 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.