DPCstruct | MC46990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 134 ± 17 aa |
| Standard deviation of domain lengths | 16.94 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B4D0N4 | 1-156 | MTGCVTLVAAAAILTGCATNNNGLQREVATQLQARVLEVTQASSQNDPASALKALDGLEADLSAAQAKGQVSEERRRSITTVATAVR… |
| A0A839EAS8 | 5-126 | ISAALTGGALVVGLLAGCVPGSSYDADTAAQLQQHVLAVSDASAAGDWATTRTRLLELEASASTALARGEITQQRFDAIMSALALVR… |
| A0A5F0G7L4 | 4-143 | None |
| A0A3B0FZR0 | 1-98 | None |
| A0A2V1HRF0 | 1-139 | None |
| A0A1T5IIJ0 | 33-164 | None |
| A0A4R8UNL9 | 1-122 | None |
| A0A2C8ZL51 | 1-125 | None |
| A0A4Q7LVN0 | 1-130 | None |
| A0A839E667 | 5-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.