DPCstruct | MC4699
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 161 ± 21 aa |
| Standard deviation of domain lengths | 20.82 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W1ECH2 | 2-128 | ESCAEARAKLVDGIKANLNIQAQELKGIQCLQKEEGTAGFKAEQASVLKIQQKGIEIRANNQKLAKEINSPAAAGLDIVAGAQVKEM… |
| A0A139AF34 | 23-157 | ATTLPPCPANTVAVANGILQNILIQRNELTQLAAVNASLGNPTAFAAAKTQFINVINSGVAVRKANQALADPANLALVAGLATVEGA… |
| A0A162ZGV7 | 8-163 | None |
| A0A166MP99 | 24-195 | None |
| A0A066XIB3 | 12-168 | None |
| A0A6A5U7B8 | 17-180 | None |
| R1G9D6 | 6-185 | None |
| A0A6A5UM72 | 6-182 | None |
| A0A317AHB3 | 231-389 | None |
| A0A6P8AR19 | 30-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.